Targets - CASP13

Control Panel: Prediction Center

Prediction Center

CASP13 Menu

Home - groups

Exper. Sequences

Predictions

Predictions Log

Evaluation System

Upload and run tasks

Tasks status

Upload results

Server status

Task details

Targets summary (SLOW!)

Queue status

Results text tables

Distribution System

distribution.log

Logger

Meeting

Registrations

Edit Targets

Sequence Name:	T0958
Target:
Sequence(s):	>gi\|87126349\|gb\|ABD20863.1\| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] MNKKSKQQEKLYNFIIAKSFQQPVGSTFTYGELRKKYNVVCSTNDQREVGRRFAYWIKYTPGLPFKIVGTKNGSLLYQKIGINPCNNSTPSKGGDC
Comments:	<em><font color=red>Canceled - paper appeared online.</font></em>
Subunit(s):	1
Target List Comments:	<em><font color=red>Canceled - paper appeared online.</font></em>
PDB Code:
Chain:
Is Server Only:
Is CAPRI:
Release date:	Today Tomorrow Day After Tomorrow Next Monday
Server Expiration:
Soft Expiration:
Human Expiration:
Cancel target:
Cancellation date:

Sequence summary:	Sequence TSID: 41 Target: T0958 SEQUENCE : >gi\|87126349\|gb\|ABD20863.1\| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] MNKKSKQQEKLYNFIIAKSFQQPVGSTFTYGELRKKYNVVCSTNDQREVGRRFAYWIKYTPGLPFKIVGTKNGSLLYQKIGINPCNNSTPSKGGDC NUMBER_OF_AA : 96 REAL_NUMBER_OF_AA : 96 SGI_CENTER : Others OLIGOMERIC_STATE : monomeric in solution BINDING_SITES : pocket for unidentified ligand ~57-67 LIGANDS : single-stranded DNA STOICHIOMETRY : A1 DISORDER : 85-96 SOLVENT : 100mM NaCitrate, pH6, 10mM MgCl2, 1.8M Li2SO4 and 14% glycerol PROTEIN_MATERIAL : YES EXPRESSION : E coli BLAST_INFO : HHSEARCH_INFO : DIFFICULTY : Other info : We identified this protein as part of our analysis of the conserved _housekeeping_ genes carried by SCCmec, the mobile genetic element that carries methicillin resistance in MRSA strains. It is encoded in the same operon as a helicase, Cch, that we also determined the structure of. We found that this protein binds ssDNA with high affinity and modest cooperativity. We determined its structure because it was only labeled _DUF1413_ in databases, and its predicted secondary structure did not match that of the OB folds that are common in ssDNA-binding proteins.

© Prediction Center, 2007-2024