Targets - CASP13

Control Panel: Prediction Center

Prediction Center

CASP13 Menu

Home - groups

Exper. Sequences

Predictions

Predictions Log

Evaluation System

Upload and run tasks

Tasks status

Upload results

Server status

Task details

Targets summary (SLOW!)

Queue status

Results text tables

Distribution System

distribution.log

Logger

Meeting

Registrations

Edit Targets

Sequence Name:	T0949
Target:
Sequence(s):	>AcoP from acidithiobacillus ferrooxidans MAAKKGMTTVLVSAVICAGVIIGALQWEKAVALPNPSGQVINGVHHYTIDEFNYYYKPDRMTWHVGEKVELTIDNRSQSAPPIAHQFSIGRTLVSRDNGFPKSQAIAVGWKDNFFDGVPITSGGQTGPVPAFSVSLNGGQKYTFSFVVPNKPGKWEYGCFLQTGQHFMNGMHGILDILPAQGS
Comments:	Starting model's GDT_HA=49. Residues 1-42, 96-105 and 182-183 are not ordered in the crystal structure and deleted from the starting model. The structure contains a bound Cu ion.
Subunit(s):	1
Target List Comments:
PDB Code:
Chain:
Is Server Only:
Is CAPRI:
Release date:	Today Tomorrow Day After Tomorrow Next Monday
Server Expiration:
Soft Expiration:
Human Expiration:
Cancel target:
Cancellation date:

Sequence summary:	Sequence TSID: 30 Target: T0949 SEQUENCE : >AcoP from acidithiobacillus ferrooxidans MAAKKGMTTVLVSAVICAGVIIGALQWEKAVALPNPSGQVINGVHHYTIDEFNYYYKPDRMTWHVGEKVELTIDNRSQSAPPIAHQFSIGRTLVSRDNGFPKSQAIAVGWKDNFFDGVPITSGGQTGPVPAFSVSLNGGQKYTFSFVVPNKPGKWEYGCFLQTGQHFMNGMHGILDILPAQGS NUMBER_OF_AA : 183 REAL_NUMBER_OF_AA : 183 SGI_CENTER : Others OLIGOMERIC_STATE : monomer BINDING_SITES : LIGANDS : Cu2+ STOICHIOMETRY : A1 DISORDER : 1-42 SOLVENT : 50 mM sodium acetate at pH 4.8, containing or not 0.005% (w/v) DDM PROTEIN_MATERIAL : YES EXPRESSION : Bacterial - Escherichia coli BLAST_INFO : HHSEARCH_INFO : DIFFICULTY : Other info : AcoP belongs to a family of copper binding protein well known as cupredoxin. A lot of structure has been solved and most of them have been described as electron shuttle. However recently few of them have been shown to play a role of metallochaperones . AcoP belongs to a respiratory chain spanning the outer membrane to the inner membrane (rare_) of an acidophilic bacteria and couple the oxidation of iron and the reduction of oxygen. Proteins involved in this chain are periplasmic and function at pH3. AcoP function in this respiratory chain is totally unknown. We know this protein has a transmembrane segment in the inner membrane and seems tightly bound to the cytochrome oxidase. Another of its partner will be a cytochrome c. Their binding sites are still unknown. Describing its spectroscopic features demonstrate interesting new properties and motivate us to solve the structure. Getting the structure, we have indeed some regions of interest that we are studying right now to determine their role and that should help us to determine the exact function of this protein.

© Prediction Center, 2007-2024