Targets - CASP13

Control Panel: Prediction Center

Prediction Center

CASP13 Menu

Home - groups

Exper. Sequences

Predictions

Predictions Log

Evaluation System

Upload and run tasks

Tasks status

Upload results

Server status

Task details

Targets summary (SLOW!)

Queue status

Results text tables

Distribution System

distribution.log

Logger

Meeting

Registrations

Edit Targets

Sequence Name:	T0951
Target:
Sequence(s):	>ShHTL7 GPLGSMSSIGLAHNVTILGSGETTVVLGHGYGTDQSVWKLLVPYLVDDYKVLLYDHMGAGTTNPDYFDFDRYSSLEGYSYDLIAILEEFQVSKCIYVGHSMSSMAAAVASIFRPDLFHKLVMISPTPRLINTEEYYGGFEQKVMDETLRSLDENFKSLSLGTAPLLLACDLESAAMQEYCRTLFNMRPDIACCITRMICGLDLRPYLGHVTVPCHIIQSSNDIMVPVAVGEYLRKNLGGPSVVEVMPTEGHLPHLSMPEVTIPVVLRHIRQDITDH
Comments:
Subunit(s):	1
Target List Comments:
PDB Code:	5z82
Chain:
Is Server Only:
Is CAPRI:
Release date:	Today Tomorrow Day After Tomorrow Next Monday
Server Expiration:
Soft Expiration:
Human Expiration:
Cancel target:
Cancellation date:

Sequence summary:	Sequence TSID: 55 Target: T0951 SEQUENCE : >ShHTL7 GPLGSMSSIGLAHNVTILGSGETTVVLGHGYGTDQSVWKLLVPYLVDDYKVLLYDHMGAGTTNPDYFDFDRYSSLEGYSYDLIAILEEFQVSKCIYVGHSMSSMAAAVASIFRPDLFHKLVMISPTPRLINTEEYYGGFEQKVMDETLRSLDENFKSLSLGTAPLLLACDLESAAMQEYCRTLFNMRPDIACCITRMICGLDLRPYLGHVTVPCHIIQSSNDIMVPVAVGEYLRKNLGGPSVVEVMPTEGHLPHLSMPEVTIPVVLRHIRQDITDH NUMBER_OF_AA : 276 REAL_NUMBER_OF_AA : 276 SGI_CENTER : Others OLIGOMERIC_STATE : Monomer BINDING_SITES : 26;124;134;139;142;143;146;150;153;157;161;190;193;194;219 LIGANDS : Triton X-100 STOICHIOMETRY : A1 DISORDER : 1-7 SOLVENT : 1 M Lithium Sulfate, 100 mM HEPES pH 7.5 PROTEIN_MATERIAL : YES EXPRESSION : Bacterial BLAST_INFO : HHSEARCH_INFO : DIFFICULTY : Other info : Striga is a parasitic weed which affects host plants such as rice through sensitizing the presence of Stigolcatones (SLs) and recognize it through a set of 11 receptors such as ShHTL 1-11. Among ShHTL family members, ShHTL7 stands out as the receptor that binds in vitro to all SLs tested with high affinity. It is one of the receptors which recognizes the presence of host next to it and help in infesting them to get all of their nutrients. --- We have one ~60% identical protein structure bound to the triton hydrophobic tail group; this hydrophobic moiety is deeply and completely bound in the protein pocket which normally only binds to very different ligands. __Special attention: This binding also requires two helices to shift by ~2 A as compared to the closest homologue.

© Prediction Center, 2007-2024