Targets - CASP13

Control Panel: Prediction Center

Prediction Center

CASP13 Menu

Home - groups

Exper. Sequences

Predictions

Predictions Log

Evaluation System

Upload and run tasks

Tasks status

Upload results

Server status

Task details

Targets summary (SLOW!)

Queue status

Results text tables

Distribution System

distribution.log

Logger

Meeting

Registrations

Edit Targets

Sequence Name:	H0953
Target:
Sequence(s):	>S16LTF_gp38:B1 MAVQGPWVGSSYVAETGQNWASLAANELRVTERPFWISSFIGRSKEEIWEWTGENHSFNKDWLIGELRNRGGTPVVINIRAHQVSYTPGAPLFEFPGDLPNAYITLNIYADIYGRGGTGGVAYLGGNPGGDCIHNWIGNRLRINNQGWICGGGGGGGGFRVGHTEAGGGGGRPLGAGGVSSLNLNGDNATLGAPGRGYQLGNDYAGNGGDVGNPGSASSAEMGGGAAGRAVVGTSPQWINVGNIAGSWL
Comments:	This is an NMR-simulated data-assisted target representing the second subunit of the H0953 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. <p> Each zip includes five (tab-delimited) text files. E.g. T0953s2_ambiR.txt (NMR-derived ambiguous contacts) T0953s2_dihed.txt (NMR-derived ranges for phi and psi) T0953s2_ECs.txt (Evolutionary constraints) T0953s2_RDCs.txt (NMR-derived residual dipolar couplings) T0953s2_seq.txt (protein/domain sequence) <p> The guidelines on the NMR-assisted data can be found at http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
Subunit(s):	2
Target List Comments:	<em><font color=red>Canceled: structure appeared in the PDB on Aug 1.</font></em>
PDB Code:
Chain:
Is Server Only:
Is CAPRI:
Release date:	Today Tomorrow Day After Tomorrow Next Monday
Server Expiration:
Soft Expiration:
Human Expiration:
Cancel target:
Cancellation date:

Sequence summary:	Sequence TSID: 51 Target: H0953 SEQUENCE : >S16LTF_gp37:A3 GALGSASIAIGDNDTGLRWGGDGIVQIVANNAIVGGWNSTDIFTEAGKHITSNGNLNQWGGGAIYCRDLNVS >S16LTF_gp38:B1 MAVQGPWVGSSYVAETGQNWASLAANELRVTERPFWISSFIGRSKEEIWEWTGENHSFNKDWLIGELRNRGGTPVVINIRAHQVSYTPGAPLFEFPGDLPNAYITLNIYADIYGRGGTGGVAYLGGNPGGDCIHNWIGNRLRINNQGWICGGGGGGGGFRVGHTEAGGGGGRPLGAGGVSSLNLNGDNATLGAPGRGYQLGNDYAGNGGDVGNPGSASSAEMGGGAAGRAVVGTSPQWINVGNIAGSWL NUMBER_OF_AA : 465 REAL_NUMBER_OF_AA : 321 SGI_CENTER : Others OLIGOMERIC_STATE : heterotetramer (trimer with monomer attached) BINDING_SITES : LIGANDS : IMD, MPD, Mg2+ STOICHIOMETRY : A3B1 DISORDER : SOLVENT : 35% (w/v) Hexylene glycol, 200 mM Magnesium Chloride, 100 mM Imidazole, pH 8.0 PROTEIN_MATERIAL : NO EXPRESSION : Bacterial BLAST_INFO : HHSEARCH_INFO : DIFFICULTY : Other info : The adhesin tip of the bacteriophage S16 long tail fiber mediates bacterial host attachment by recognising specific cell surface receptors. A single receptor-binding adhesin (gp38) attaches to a trimeric gp37 helix during fiber assembly at the end of the long tail fiber. Understanding the structure of the S16 gp38 adhesin not only benefits our understanding of phage-host interactions, but can be exploited to guide phage engineering to develop phage with altered host ranges for various applications, such as therapeutics (e.g., phage therapy).

© Prediction Center, 2007-2024