Targets - CASP13

Control Panel: Prediction Center

Prediction Center

CASP13 Menu

Home - groups

Exper. Sequences

Predictions

Predictions Log

Evaluation System

Upload and run tasks

Tasks status

Upload results

Server status

Task details

Targets summary (SLOW!)

Queue status

Results text tables

Distribution System

distribution.log

Logger

Meeting

Registrations

Edit Targets

Sequence Name:	H0980
Target:
Sequence(s):	>Majin:A SLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEDSVRVVLGNLDNLQPFATEHFIVFPYKSKWERVSHLKFKHGEIILIPYPFVFTLYVEMKWFHE
Comments:	This is a SAXS-assisted target representing the first subunit of the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
Subunit(s):	1
Target List Comments:
PDB Code:
Chain:
Is Server Only:
Is CAPRI:
Release date:	Today Tomorrow Day After Tomorrow Next Monday
Server Expiration:
Soft Expiration:
Human Expiration:
Cancel target:
Cancellation date:

Sequence summary:	Sequence TSID: 81 Target: H0980 SEQUENCE : >Majin:A SLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEDSVRVVLGNLDNLQPFATEHFIVFPYKSKWERVSHLKFKHGEIILIPYPFVFTLYVEMKWFHE >Terb2:B VNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK NUMBER_OF_AA : 163 REAL_NUMBER_OF_AA : 163 SGI_CENTER : Others OLIGOMERIC_STATE : 2:2 BINDING_SITES : N/A LIGANDS : N/A STOICHIOMETRY : A2B2 DISORDER : A106-111, B1-5, B37-52 SOLVENT : 20 mM Tris pH 8.0, 150 mM KCl, 2 mM DTT PROTEIN_MATERIAL : YES EXPRESSION : Bacterial BLAST_INFO : HHSEARCH_INFO : DIFFICULTY : Other info : This complex tethers the telomeric ends of meiotic chromosomes to the inner nuclear membrane to facilitate the rapid chromosomal movement in meiotic prophase I that facilitates the identification of homologous chromosome pairs through recombination. The importance of the structure lies in determining the architecture of the wider complex that is built around this 2:2 complex, and its orientation with respect to the nuclear membrane (inferred from transmembrane helices downstream in Majin). The structure was solved by SAD phasing of a selenomethionine derivative. We can also provide SAXS and MALS data from which we had predicted the overall shape of the complex. Please note that the structure included has not yet been fully refined although the build is complete.

© Prediction Center, 2007-2024