Sequences - CASP13

Control Panel: Prediction Center

Prediction Center

CASP13 Menu

Home - groups

Exper. Sequences

Predictions

Predictions Log

Evaluation System

Upload and run tasks

Tasks status

Upload results

Server status

Task details

Targets summary (SLOW!)

Queue status

Results text tables

Distribution System

distribution.log

Logger

Meeting

Registrations

Edit Sequence

Extra information
TSID:	76
Target:
Comments:	human

Submitted information
Protein Name:
Organism Name:
Number of AA:	/ 184
Amino acid sequence:	>CBM56 NVPVTGVTVNPTTAQVEVGQSVQLNASVAPSNATNKQVTWSVSGSSIASVSPNGLVTGLAQGTTTVTATTADGNKAASATITVAPAPSTVIVIGDEVKGLKKIGDDLLFYVNGATFADLHYKVNNGGQLNVAMAPTGNGNYTYPVHNLKHGDTVEYFFTYNPGQGALDTPWQTYVHGVTQGTPE
SGI Center:
Binding sites:
Ligands:
Oligomeric state:
Stoichiometry:
pH and solvent composition:
Expression system used:
Disordered regions:
BLAST info:
HHSearch info:
Difficulty:
Other information:	From Shabir: CBM56 - a Carbohydrate Binding Module from a beta-1,3-glucanase _Bacillus circulans_ - 694 to 877 (184 aa) of Sequence ID: AAC60453.1 Length: 877. We tried to solve the structure of both parts of the CBM56, got crystals and some data, but weren_t able to solve it. So we took the second part - CBM56b and used SeMet-derivatised crystals to solve it. So this CBM56b would be the target and I am attaching the pdb for it. However, I thought it would be more interesting to see if the predictors could try modelling the whole thing and see if they can get sensible arrangements for the two parts - solved (CBM56b) and unsolved (CBM56a). These are the sequences: _ CBM56 - complete NVPVTGVTVNPTTAQVEVGQSVQLNASVAPSNATNKQVTWSVSGSSIASVSPNGLVTGLAQGTTTVTATTADGNKAASATITVAPAPSTVIVIGDEVKGLKKIGDDLLFYVNGATFADLHYKVNNGGQLNVAMAPTGNGNYTYPVHNLKHGDTVEYFFTYNPGQGALDTPWQTYVHGVTQGTPE _ CBM56_A NVPVTGVTVN PTTAQVEVGQ SVQLNASVAP SNATNKQVTW SVSGSSIASV SPNGLVTGLA QGTTTVTATT ADGNKAASAT ITVAPAPSTV IVIGD _ CBM56_B VIVIGDEVKGLKKIGDDLLFYVNGATFADLHYKVNNGGQLNVAMAPTGNGNYTYPVHNLKHGDTVEYFFTYNPGQGALDTPWQTYVHGVTQGTPE At first we thought the whole sequence was one complete thing, but on closer analysis we realised that it_s probably two independent tandem CBM modules. Even though we got crystals of the protein with both modules i.e. CBM56a and b, there is probably a flexible linker between them and the arrangement between the two modules is not homogeneous in the crystals. Hence we didn_t get good data to be able to solve it. I haven_t looked at it in great detail recently so am a bit hazy about it, but I think the modules should be homologous and both should have a similar structure to the one we have solved (CBM56b). So the interest would be to see if they are likely to pair up or be totally flexible and be independent.
Method:	X-RAY NMR EM
Protein material available?	Yes No
Estimated date of public release of structure:	2018-01-01
Contact person email:

© Prediction Center, 2007-2024