Sequences - CASP13

Control Panel: Prediction Center

Prediction Center

CASP13 Menu

Home - groups

Exper. Sequences

Predictions

Predictions Log

Evaluation System

Upload and run tasks

Tasks status

Upload results

Server status

Task details

Targets summary (SLOW!)

Queue status

Results text tables

Distribution System

distribution.log

Logger

Meeting

Registrations

Edit Sequence

Extra information
TSID:	41
Target:
Comments:	medium, human

Submitted information
Protein Name:
Organism Name:
Number of AA:	/ 96
Amino acid sequence:	>gi\|87126349\|gb\|ABD20863.1\| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] MNKKSKQQEKLYNFIIAKSFQQPVGSTFTYGELRKKYNVVCSTNDQREVGRRFAYWIKYTPGLPFKIVGTKNGSLLYQKIGINPCNNSTPSKGGDC
SGI Center:
Binding sites:
Ligands:
Oligomeric state:
Stoichiometry:
pH and solvent composition:
Expression system used:
Disordered regions:
BLAST info:
HHSearch info:
Difficulty:
Other information:	We identified this protein as part of our analysis of the conserved _housekeeping_ genes carried by SCCmec, the mobile genetic element that carries methicillin resistance in MRSA strains. It is encoded in the same operon as a helicase, Cch, that we also determined the structure of. We found that this protein binds ssDNA with high affinity and modest cooperativity. We determined its structure because it was only labeled _DUF1413_ in databases, and its predicted secondary structure did not match that of the OB folds that are common in ssDNA-binding proteins.
Method:	X-RAY NMR EM
Protein material available?	Yes No
Estimated date of public release of structure:	2018-06-01
Contact person email:

© Prediction Center, 2007-2024